Structure of PDB 8wi8 Chain 7

Receptor sequence

>8wi87 (length=46) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

AKGKRTFQPNNRRRARVHGFRLRMRTRAGRAIVANRRSKGRRALTA

3D structure

• PDB: 8wi8 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
• Chain: 7
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	7	A2 K5 R6 T7 F8 Q9 P10 N11 N12 R13 R14 R15 A16 R17 H19 G20 F21 R22 R24 R28 A29 I33 R37 R38 K40 G41 R42 R43	A1 K4 R5 T6 F7 Q8 P9 N10 N11 R12 R13 R14 A15 R16 H18 G19 F20 R21 R23 R27 A28 I32 R36 R37 K39 G40 R41 R42

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8wi8, PDBe:8wi8, PDBj:8wi8
• PDBsum: 8wi8
• PubMed: 38245551
• UniProt: A0R7K0|RL34_MYCS2 Large ribosomal subunit protein bL34 (Gene Name=rpmH)