Structure of PDB 8wi7 Chain 7

Receptor sequence
>8wi77 (length=46) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
AKGKRTFQPNNRRRARVHGFRLRMRTRAGRAIVANRRSKGRRALTA
3D structure
PDB8wi7 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chain7
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 7 A2 K3 G4 K5 R6 T7 F8 Q9 P10 N11 N12 R13 R14 A16 H19 G20 F21 R22 R28 R37 R38 K40 R42 L45 A1 K2 G3 K4 R5 T6 F7 Q8 P9 N10 N11 R12 R13 A15 H18 G19 F20 R21 R27 R36 R37 K39 R41 L44
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wi7, PDBe:8wi7, PDBj:8wi7
PDBsum8wi7
PubMed38245551
UniProtA0R7K0|RL34_MYCS2 Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]