Structure of PDB 8wao Chain 7

Receptor sequence
>8wao7 (length=714) Species: 9606 (Homo sapiens) [Search protein sequence]
MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTV
SLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGE
KLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDT
SLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSIL
HANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVN
LTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGANPVLPDEV
LQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQR
VCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGF
TIIIEPFDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPL
DIYPKILDFHPVTMATFTMTLARVCLCPMIIGRGNDQVAISSKFETREDI
AVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILENIQRN
KLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHY
GRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCV
GRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGV
QVAKYFLRQMAQPF
3D structure
PDB8wao Structural Visualization of de novo Transcription Initiation.
Chain7
Resolution6.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 7 C116 H118 C134 C155 F157 C190 F193 C116 H118 C134 C155 F157 C190 F193
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0003684 damaged DNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0016853 isomerase activity
GO:0016887 ATP hydrolysis activity
GO:0030674 protein-macromolecule adaptor activity
GO:0043139 5'-3' DNA helicase activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001666 response to hypoxia
GO:0001701 in utero embryonic development
GO:0006139 nucleobase-containing compound metabolic process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0006289 nucleotide-excision repair
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006362 transcription elongation by RNA polymerase I
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0006979 response to oxidative stress
GO:0007059 chromosome segregation
GO:0008340 determination of adult lifespan
GO:0009411 response to UV
GO:0009650 UV protection
GO:0009791 post-embryonic development
GO:0021510 spinal cord development
GO:0022405 hair cycle process
GO:0030198 extracellular matrix organization
GO:0030282 bone mineralization
GO:0032289 central nervous system myelin formation
GO:0032508 DNA duplex unwinding
GO:0035264 multicellular organism growth
GO:0035315 hair cell differentiation
GO:0040016 embryonic cleavage
GO:0042274 ribosomal small subunit biogenesis
GO:0043249 erythrocyte maturation
GO:0043588 skin development
GO:0045951 positive regulation of mitotic recombination
GO:0048009 insulin-like growth factor receptor signaling pathway
GO:0048568 embryonic organ development
GO:0048820 hair follicle maturation
GO:0060218 hematopoietic stem cell differentiation
GO:0071425 hematopoietic stem cell proliferation
GO:0072332 intrinsic apoptotic signaling pathway by p53 class mediator
GO:1901990 regulation of mitotic cell cycle phase transition
Cellular Component
GO:0000439 transcription factor TFIIH core complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005675 transcription factor TFIIH holo complex
GO:0005737 cytoplasm
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0070516 CAK-ERCC2 complex
GO:0071817 MMXD complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wao, PDBe:8wao, PDBj:8wao
PDBsum8wao
PubMed38127763
UniProtP18074|ERCC2_HUMAN General transcription and DNA repair factor IIH helicase subunit XPD (Gene Name=ERCC2)

[Back to BioLiP]