Structure of PDB 8uu9 Chain 7

Receptor sequence
>8uu97 (length=65) Species: 1642 (Listeria innocua) [Search protein sequence]
PKMKTHRGSAKRFKRTGSGKLKRRHGFTSHMFANKSQKQKRKLRKSAMVS
AGDFKRIRQMVAKMK
3D structure
PDB8uu9 Mechanistic insights into the alternative ribosome recycling by HflXr.
Chain7
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 7 P2 K3 M4 K5 T6 H7 R8 K12 R13 K15 T17 S19 R24 G27 F28 S30 H31 F33 A34 N35 Q38 K39 Q40 R42 K43 R45 K46 D54 R57 Q60 K64 P1 K2 M3 K4 T5 H6 R7 K11 R12 K14 T16 S18 R23 G26 F27 S29 H30 F32 A33 N34 Q37 K38 Q39 R41 K42 R44 K45 D53 R56 Q59 K63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8uu9, PDBe:8uu9, PDBj:8uu9
PDBsum8uu9
PubMed38407413
UniProtA0A660JIB9

[Back to BioLiP]