Structure of PDB 8rgq Chain 7

Receptor sequence
>8rgq7 (length=96) Species: 10090 (Mus musculus) [Search protein sequence]
GVQVSPSGEKITHTGQVYDEKDYRRVRFVDRQKEVNENFAIDLIAQQPVN
EVEHRIIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFKQHHH
3D structure
PDB8rgq SCAF1 drives the compositional diversity of mammalian respirasomes.
Chain7
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN 7 C59 H68 C84 C87 C59 H68 C84 C87
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0001822 kidney development
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0006631 fatty acid metabolic process
GO:0006936 muscle contraction
GO:0007005 mitochondrion organization
GO:0009060 aerobic respiration
GO:0010467 gene expression
GO:0017145 stem cell division
GO:0022904 respiratory electron transport chain
GO:0030330 DNA damage response, signal transduction by p53 class mediator
GO:0032981 mitochondrial respiratory chain complex I assembly
GO:0035264 multicellular organism growth
GO:0042391 regulation of membrane potential
GO:0042776 proton motive force-driven mitochondrial ATP synthesis
GO:0051881 regulation of mitochondrial membrane potential
GO:0061458 reproductive system development
GO:0072359 circulatory system development
GO:0072497 mesenchymal stem cell differentiation
GO:0072593 reactive oxygen species metabolic process
GO:0090398 cellular senescence
GO:0097168 mesenchymal stem cell proliferation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8rgq, PDBe:8rgq, PDBj:8rgq
PDBsum8rgq
PubMed38575788
UniProtP52503|NDUS6_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial (Gene Name=Ndufs6)

[Back to BioLiP]