Structure of PDB 8qpb Chain 7

Receptor sequence
>8qpb7 (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
EYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAP
GLDIESSLKQLAERRTDIFGVEETAIGKKIGPEEKVTWDGHSGSMARTQQ
AAQANIT
3D structure
PDB8qpb Structural insights into the cross-exon to cross-intron spliceosome switch
Chain7
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 7 R430 I431 L434 R437 W438 Q441 R22 I23 L26 R29 W30 Q33
BS02 rna 7 G504 H505 S506 G90 H91 S92
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0016607 nuclear speck
GO:0071004 U2-type prespliceosome
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qpb, PDBe:8qpb, PDBj:8qpb
PDBsum8qpb
PubMed38778104
UniProtQ15459|SF3A1_HUMAN Splicing factor 3A subunit 1 (Gene Name=SF3A1)

[Back to BioLiP]