Structure of PDB 8iwh Chain 7

Receptor sequence

>8iwh7 (length=165) Species: 35128 (Thalassiosira pseudonana) [Search protein sequence]

LVGALPPVGFFDPAGFAAKASPEELARYREVEIMHGRFAQMAVLGFIIPE
KCAYDGAFGDDFLAPTGRALEAINTDPVWLALTLGVISALETLRLLQTEP
GTRTDAKIEGLGWRPKSEAEFVNYQVRELQQGRLAMLAFAGEIAQELVNE
KPLLVNLQDSGFVSW

3D structure

PDB

8iwh Structure of a diatom photosystem II supercomplex containing a member of Lhcx family and dimeric FCPII

Chain

Resolution

2.68 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	ET4	7	F45 D46 P47 A48 H69 A76 F80 M170 F173	F11 D12 P13 A14 H35 A42 F46 M136 F139
BS02	A86	7	Q74 L145 G146 L168 A169 A172 E176 Q179	Q40 L111 G112 L134 A135 A138 E142 Q145
BS03	CLA	7	L39 P41 R161 Q164	L5 P7 R127 Q130
BS04	CLA	7	G37 A38 F45 D46 F50 A51 Y62 E66 R167 M170	G3 A4 F11 D12 F16 A17 Y28 E32 R133 M136
BS05	KC2	7	R61 Y62 H69	R27 Y28 H35
BS06	CLA	7	M75 G79 W113 T117	M41 G45 W79 T83
BS07	CLA	7	M68 H69 F72 S122 E125 R128 L129	M34 H35 F38 S88 E91 R94 L95
BS08	CLA	7	R71 Q74 M75 D139 A140 R148 Q159 E162	R37 Q40 M41 D105 A106 R114 Q125 E128
BS09	CLA	7	Y158 Q165 L168	Y124 Q131 L134
BS10	CLA	7	G175 V182	G141 V148
BS11	CLA	7	M75 L124 L127 R128 A140	M41 L90 L93 R94 A106
BS12	CLA	7	F196 V197 S198	F162 V163 S164

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8iwh, PDBe:8iwh, PDBj:8iwh
PDBsum	8iwh
PubMed	37878698
UniProt	B5YLU3

[Back to BioLiP]