Structure of PDB 8htu Chain 7

Receptor sequence

>8htu7 (length=219) Species: 3218 (Physcomitrium patens) [Search protein sequence]

RSLIFASKQSLSYLDGTLPGDYGFDPLGLMDPEGAGGFIDPQWLPYAEII
NGRFAMLGAAGAIAPEVLGRIGLIPQETAIPWFQSGVIPPVGNYSYWADP
YTLFVLEMALMGFAEHRRAQDYYKPGSMGKQYFLGLEKFLGGSGNPAYPG
GPIFNFLGFGKNEKELQELKVKEVKNGRLAMMAVLGYFTQAIFTGVGPFQ
NLLDHLADPVHNNVLTNLK

3D structure

PDB

8htu Structural insights into the assembly and energy transfer of the Lhcb9-dependent photosystem I from moss Physcomitrium patens.

Chain

Resolution

2.87 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	7	F215 H218 R219	F113 H116 R117
BS02	CLA	7	L208 F215	L106 F113
BS03	CLA	7	L116 D123 Y124 G125 F126 D127 M132 L146 P147 E150 N153 R280 M283	L14 D21 Y22 G23 F24 D25 M30 L44 P45 E48 N51 R178 M181
BS04	CLA	7	L159 G163 P167 Y198	L57 G61 P65 Y96
BS05	CLA	7	S187 Y198 L205 L208 E209 L212	S85 Y96 L103 L106 E107 L110
BS06	CLA	7	W184 V189 I190 P191 Y203 L205 F206 E209 F290	W82 V87 I88 P89 Y101 L103 F104 E107 F188
BS07	CHL	7	R155 F156 A216 R220 D223 L242 P251 F256	R53 F54 A114 R118 D121 L140 P149 F154
BS08	CLA	7	W145 Y148 A149 I152 N153 F156 M210 M213 G214 E217 H218 R220 A221	W43 Y46 A47 I50 N51 F54 M108 M111 G112 E115 H116 R118 A119
BS09	CLA	7	R155 M158 G252 F261 L271 E275 N278	R53 M56 G150 F159 L169 E173 N176
BS10	CLA	7	K274 K277	K172 K175
BS11	CLA	7	K274 N278 L281	K172 N176 L179
BS12	CLA	7	M284 L287 G288 T291 Q292 N303 N314 V316 N319	M182 L185 G186 T189 Q190 N201 N212 V214 N217
BS13	CLA	7	H307 L308	H205 L206
BS14	CLA	7	L175 P177	L73 P75

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8htu, PDBe:8htu, PDBj:8htu
PDBsum	8htu
PubMed	37474782
UniProt	A0A2K1IB10

[Back to BioLiP]