Structure of PDB 8csq Chain 7

Receptor sequence

>8csq7 (length=398) Species: 9606 (Homo sapiens)

AALVPGVTQVDNKSGFLQKRPHRQHPGILKLPHVRLPQALANGAQLLLLG
SAGPTMENQVQTLTSYLWSRHLPVEPEELQRRARHLEKKAVLHALRKTTY
HWQELSYTEGLSLVYMAARLDGGFAAVSRAFHEIRARNPAFQPQTLMDFG
SGTGSVTWAAHSIWGQSLREYMCVDRSAAMLVLAEKLLKGGSESGEPYIP
GVFFRQFLPVSPKVQFDVVVSAFSLSELPSKADRTEVVQTLWRKTGHFLV
LVENGTKAGHSLLMDARDLVLKGKEKSPLDPRPGFVFAPCPHELPCPQLT
NLACSFSQAYHPIPFSWNKKPKEEKFSMVILARGSPEEAHRWPRITQPVL
KRPRHVHCHLCCPDGHMQHAVLTARRHGRDLYRCARVSSWGDLLPVLT

3D structure

• PDB: 8csq Principles of mitoribosomal small subunit assembly in eukaryotes.
• Chain: 7
• Resolution: 2.54 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	7	R50 P59 H60 S92 Y93 S96 H98 K140 T141 Y143 H144 S149 F250 V253 R286 T299 K300 E318 Q341 L345 A346 S348 H354 Q390 L393 R395 P396 R397 H398 H400 V414 T416 R418 R426 R429	R23 P32 H33 S65 Y66 S69 H71 K97 T98 Y100 H101 S106 F207 V210 R243 T256 K257 E275 Q298 L302 A303 S305 H311 Q347 L350 R352 P353 R354 H355 H357 V371 T373 R375 R383 R386
BS02	SF4	7	M307 P332 C333 H335 C339 P340 Q341 C347 C404	M264 P289 C290 H292 C296 P297 Q298 C304 C361
BS03	SAM	7	Y150 Y158 F192 G193 G195 S198 D218 R219 A265 F266 L271	Y107 Y115 F149 G150 G152 S155 D175 R176 A222 F223 L228

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding
• GO:1904047 S-adenosyl-L-methionine binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis
• GO:0180026 mitochondrial small ribosomal subunit assembly

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix

External links

• PDB: RCSB:8csq, PDBe:8csq, PDBj:8csq
• PDBsum: 8csq
• PubMed: 36482135
• UniProt: Q9H7H0|MET17_HUMAN Ribosome assembly protein METTL17, mitochondrial (Gene Name=METTL17)