Structure of PDB 7va9 Chain 7
Receptor sequence
| >7va97 (length=46) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence] |
| MSKFYKIWMIFDPRRVFVAQGVFLFLLAVMIHLILLSTPSYNWLEI |
3D structure
| PDB | 7va9 Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex. | ||
| Chain | 7 | ||
| Resolution | 3.08 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | BCL | 7 | L24 H32 W43 | L24 H32 W43 | |
| BS02 | SPO | 7 | Q20 L27 I34 | Q20 L27 I34 | |
| BS03 | BCL | 7 | I31 H32 Y41 | I31 H32 Y41 | |
| BS04 | SPO | 7 | K6 I10 | K6 I10 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0042314 | bacteriochlorophyll binding |
| GO:0045156 | electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity |
| GO:0046872 | metal ion binding |
