Structure of PDB 7unr Chain 7

Receptor sequence
>7unr7 (length=63) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
PKMKTKSGAAKRFKKTAGGLKHKHAFKSHILTKMTTKRKRQLRGTSMLNK
SDVARVERSLRLR
3D structure
PDB7unr Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Chain7
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 7 P2 K3 M4 K5 T6 S8 K12 R13 A18 G19 K22 H25 A26 F27 S29 H30 L32 T33 K34 T37 K38 R39 K40 R41 R44 D53 R56 R59 R62 R64 P1 K2 M3 K4 T5 S7 K11 R12 A17 G18 K21 H24 A25 F26 S28 H29 L31 T32 K33 T36 K37 R38 K39 R40 R43 D52 R55 R58 R61 R63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7unr, PDBe:7unr, PDBj:7unr
PDBsum7unr
PubMed
UniProtQ9I0A1|RL35_PSEAE Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]