Structure of PDB 7r7c Chain 7

Receptor sequence
>7r7c7 (length=104) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
SQARNQLANKPSKTKVKKEQSLARLYGAKDLNIPTLNRAIVPGVKIRRGK
KGKKFIADNDTLTLNRLITTIGDKYDDIAESKLEKARRLEEIRELKRKEI
ERKE
3D structure
PDB7r7c Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Chain7
Resolution3.71 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 7 K51 Q54 R58 Y60 G93 K94 K95 F99 K17 Q20 R24 Y26 G49 K50 K51 F55
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000055 ribosomal large subunit export from nucleus
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0008298 intracellular mRNA localization
GO:0017148 negative regulation of translation
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
GO:0051028 mRNA transport
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor
GO:0101031 protein folding chaperone complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7r7c, PDBe:7r7c, PDBj:7r7c
PDBsum7r7c
PubMed36482249
UniProtP43586|LOC1_YEAST 60S ribosomal subunit assembly/export protein LOC1 (Gene Name=LOC1)

[Back to BioLiP]