Structure of PDB 7nvx Chain 7

Receptor sequence

>7nvx7 (length=605) Species: 9606 (Homo sapiens)

TKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFL
VAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPD
GIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLR
QTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAV
LRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLG
NSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGH
TTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLG
LTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMS
PEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNV
FALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSF
DLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQ
DTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQK
VLAAT

3D structure

• PDB: 7nvx Structures of mammalian RNA polymerase II pre-initiation complexes.
• Chain: 7
• Resolution: 3.9 Å

Enzymatic activity

• Enzyme Commision number: 5.6.2.4: DNA 3'-5' helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	7	T416 T417 T445 A448 M450 F451 R472 E473 H629 G631 S632 R634 Y672	T301 T302 T330 A333 M335 F336 R357 E358 H514 G516 S517 R519 Y557
BS02	dna	7	H415 K418 R419 S420 N564 V565 G582 S608 V610	H300 K303 R304 S305 N449 V450 G467 S493 V495
BS03	peptide	7	Q506 F546 F550 R554 Y655 F658 Y660 K688 I690 T691 K692 L693 A694	Q391 F431 F435 R439 Y540 F543 Y545 K573 I575 T576 K577 L578 A579
BS04	peptide	7	R198 L199 R200 T267 V268 S269	R148 L149 R150 T152 V153 S154
BS05	peptide	7	N595 H598	N480 H483
BS06	ADP	7	R317 G343 G345 K346 S347 D616 R645	R202 G228 G230 K231 S232 D501 R530
BS07	BEF	7	C342 K346 R642 R645	C227 K231 R527 R530

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003678 DNA helicase activity
• GO:0003684 damaged DNA binding
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016853 isomerase activity
• GO:0016887 ATP hydrolysis activity
• GO:0043138 3'-5' DNA helicase activity
• GO:1990841 promoter-specific chromatin binding

Biological Process

• GO:0000717 nucleotide-excision repair, DNA duplex unwinding
• GO:0001666 response to hypoxia
• GO:0006265 DNA topological change
• GO:0006281 DNA repair
• GO:0006283 transcription-coupled nucleotide-excision repair
• GO:0006289 nucleotide-excision repair
• GO:0006366 transcription by RNA polymerase II
• GO:0006367 transcription initiation at RNA polymerase II promoter
• GO:0006368 transcription elongation by RNA polymerase II
• GO:0006915 apoptotic process
• GO:0006979 response to oxidative stress
• GO:0008104 protein localization
• GO:0009411 response to UV
• GO:0009650 UV protection
• GO:0035315 hair cell differentiation
• GO:0043065 positive regulation of apoptotic process
• GO:0048568 embryonic organ development
• GO:1901990 regulation of mitotic cell cycle phase transition

Cellular Component

• GO:0000112 nucleotide-excision repair factor 3 complex
• GO:0000439 transcription factor TFIIH core complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005669 transcription factor TFIID complex
• GO:0005675 transcription factor TFIIH holo complex
• GO:0097550 transcription preinitiation complex

External links

• PDB: RCSB:7nvx, PDBe:7nvx, PDBj:7nvx
• PDBsum: 7nvx
• PubMed: 33902107
• UniProt: P19447|ERCC3_HUMAN General transcription and DNA repair factor IIH helicase/translocase subunit XPB (Gene Name=ERCC3)