Structure of PDB 7nvw Chain 7

Receptor sequence

>7nvw7 (length=605) Species: 9606 (Homo sapiens)

TKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFL
VAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPD
GIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLR
QTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAV
LRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLG
NSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGH
TTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLG
LTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMS
PEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNV
FALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSF
DLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQ
DTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQK
VLAAT

3D structure

• PDB: 7nvw Structures of mammalian RNA polymerase II pre-initiation complexes.
• Chain: 7
• Resolution: 4.3 Å

Enzymatic activity

• Enzyme Commision number: 5.6.2.4: DNA 3'-5' helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	7	T417 A448 K449 M450 F451 R472 K528 H629 G631 Y672	T302 A333 K334 M335 F336 R357 K413 H514 G516 Y557
BS02	dna	7	S367 A368 S394 S411 M412 R419 S608 K609 V610	S252 A253 S279 S296 M297 R304 S493 K494 V495
BS03	peptide	7	F546 F550 R554 F658 K688 I690 T691 A694	F431 F435 R439 F543 K573 I575 T576 A579
BS04	peptide	7	R198 L199 R200 Q266 T267 V268 S269	R148 L149 R150 Q151 T152 V153 S154
BS05	peptide	7	Y581 E588 N595 H598	Y466 E473 N480 H483

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003678 DNA helicase activity
• GO:0003684 damaged DNA binding
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016853 isomerase activity
• GO:0016887 ATP hydrolysis activity
• GO:0043138 3'-5' DNA helicase activity
• GO:1990841 promoter-specific chromatin binding

Biological Process

• GO:0000717 nucleotide-excision repair, DNA duplex unwinding
• GO:0001666 response to hypoxia
• GO:0006265 DNA topological change
• GO:0006281 DNA repair
• GO:0006283 transcription-coupled nucleotide-excision repair
• GO:0006289 nucleotide-excision repair
• GO:0006366 transcription by RNA polymerase II
• GO:0006367 transcription initiation at RNA polymerase II promoter
• GO:0006368 transcription elongation by RNA polymerase II
• GO:0006915 apoptotic process
• GO:0006979 response to oxidative stress
• GO:0008104 protein localization
• GO:0009411 response to UV
• GO:0009650 UV protection
• GO:0035315 hair cell differentiation
• GO:0043065 positive regulation of apoptotic process
• GO:0048568 embryonic organ development
• GO:1901990 regulation of mitotic cell cycle phase transition

Cellular Component

• GO:0000112 nucleotide-excision repair factor 3 complex
• GO:0000439 transcription factor TFIIH core complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005669 transcription factor TFIID complex
• GO:0005675 transcription factor TFIIH holo complex
• GO:0097550 transcription preinitiation complex

External links

• PDB: RCSB:7nvw, PDBe:7nvw, PDBj:7nvw
• PDBsum: 7nvw
• PubMed: 33902107
• UniProt: P19447|ERCC3_HUMAN General transcription and DNA repair factor IIH helicase/translocase subunit XPB (Gene Name=ERCC3)