Structure of PDB 7nac Chain 7

Receptor sequence

>7nac7 (length=129) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

QNLRREVAPEVFQDSQARNQLANVPHLTEKSAQRKPSKTKVKKEQSLARL
YGAKDLNIPTLNRAIVPGVKIRRGKKGKKFIADNDTLTLNRLITTIGDKY
DDIAESKLEKARRLEEIRELKRKEIERKE

3D structure

PDB

7nac Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

Chain

Resolution

3.04 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	7	N11 L12 R13 R14 E19 Q42 T48 K49 K51 Q54 L56 R58 Y60 K94 K95 K97	N2 L3 R4 R5 E10 Q33 T39 K40 K42 Q45 L47 R49 Y51 K75 K76 K78

Gene Ontology

	Biological Process
GO:0000055	ribosomal large subunit export from nucleus
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0008298	intracellular mRNA localization
GO:0017148	negative regulation of translation
GO:0042254	ribosome biogenesis
GO:0042273	ribosomal large subunit biogenesis
GO:0051028	mRNA transport

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0030687	preribosome, large subunit precursor
GO:0101031	protein folding chaperone complex

External links

PDB	RCSB:7nac, PDBe:7nac, PDBj:7nac
PDBsum	7nac
PubMed	36482249
UniProt	P43586\|LOC1_YEAST 60S ribosomal subunit assembly/export protein LOC1 (Gene Name=LOC1)