Structure of PDB 6ywx Chain 7

Receptor sequence
>6ywx7 (length=84) Species: 367110 (Neurospora crassa OR74A) [Search protein sequence]
AKPYLVGRAWTQRLPVYHLAKRGGNKKLTQIKKVQGDGQALRRDLAQFLG
LEVKEVRVKVPTGHLEVDGHRREEIVKFLDGLGF
3D structure
PDB6ywx Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
Chain7
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 7 A90 W91 T92 R94 Y98 K102 R103 G104 N106 K113 K114 V141 T143 A9 W10 T11 R13 Y17 K21 R22 G23 N25 K32 K33 V60 T62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005739 mitochondrion
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ywx, PDBe:6ywx, PDBj:6ywx
PDBsum6ywx
PubMed33056988
UniProtQ7S518|IMG2_NEUCR Large ribosomal subunit protein mL49 (Gene Name=img2)

[Back to BioLiP]