Structure of PDB 6uzv Chain 7

Receptor sequence
>6uzv7 (length=39) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence]
MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFH
3D structure
PDB6uzv The structure of a red-shifted photosystem I reveals a red site in the core antenna.
Chain7
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA 7 A11 I15 L18 A11 I15 L18
BS02 CLA 7 L19 A23 L19 A23
BS03 CLA 7 D35 L36 D35 L36
BS04 CLA 7 I15 L18 T22 L26 I15 L18 T22 L26
BS05 CLA 7 F7 A11 P12 I15 F7 A11 P12 I15
BS06 CLA 7 G24 I25 E28 R31 G24 I25 E28 R31
BS07 CLA 7 F29 H39 F29 H39
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uzv, PDBe:6uzv, PDBj:6uzv
PDBsum6uzv
PubMed33077842
UniProtQ55329|PSAJ_SYNY3 Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]