Structure of PDB 6swc Chain 7

Receptor sequence

>6swc7 (length=414) Species: 272844 (Pyrococcus abyssi GE5)

AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGY
AETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLM
ATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKV
DVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEY
IKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQ
EIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYL
DPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPI
RAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQI
AGRWRMIGWGLVEI

3D structure

• PDB: 6swc Cryo-EM study of an archaeal 30S initiation complex gives insights into evolution of translation initiation.
• Chain: 7
• Resolution: 3.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D19 K22 T23 T46 H97
• Catalytic site (residue number reindexed from 1): D18 K21 T22 T45 H96
• Enzyme Commision number: 3.6.5.3: protein-synthesizing GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	7	K36 F221 V223 S278 R280 A296	K35 F220 V222 S277 R279 A295
BS02	MET	7	Y51 R280 L294 A296	Y50 R279 L293 A295
BS03	GNP	7	D19 H20 G21 K22 T24 M45 T46 K150 A185 L186	D18 H19 G20 K21 T23 M44 T45 K149 A184 L185

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003743 translation initiation factor activity
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0001731 formation of translation preinitiation complex
• GO:0006412 translation
• GO:0006413 translational initiation
• GO:0006414 translational elongation

External links

• PDB: RCSB:6swc, PDBe:6swc, PDBj:6swc
• PDBsum: 6swc
• PubMed: 32029867
• UniProt: Q980A5|IF2G_SACS2 Translation initiation factor 2 subunit gamma (Gene Name=eif2g)