Structure of PDB 6hhq Chain 7

Receptor sequence
>6hhq7 (length=98) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIA
WTVLFRKHHKKGITEEVAKKRSRKTVKAQRPITGASLDLIKERRSLKP
3D structure
PDB6hhq Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.
Chain7
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 7 G16 R17 G18 S34 K35 S38 K44 R48 I49 W51 R56 K61 G16 R17 G18 S34 K35 S38 K44 R48 I49 W51 R56 K61
BS02 rna 7 R47 T83 R47 T83
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006413 translational initiation
GO:0006414 translational elongation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hhq, PDBe:6hhq, PDBj:6hhq
PDBsum6hhq
PubMed30759226
UniProtP04449|RL24A_YEAST Large ribosomal subunit protein eL24A (Gene Name=RPL24A)

[Back to BioLiP]