Structure of PDB 5uq8 Chain 7

Receptor sequence

>5uq87 (length=48) Species: 300852 (Thermus thermophilus HB8)

MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRK

3D structure

• PDB: 5uq8 Alternative Mode of E-Site tRNA Binding in the Presence of a Downstream mRNA Stem Loop at the Entrance Channel.
• Chain: 7
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	7	M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 K14 T15 H16 G17 F18 R19 R21 P25 G26 G27 R28 K29 V30 K32 R33 R34 R35 K37 G38 R39 W40 R41 R47 K48	M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 K14 T15 H16 G17 F18 R19 R21 P25 G26 G27 R28 K29 V30 K32 R33 R34 R35 K37 G38 R39 W40 R41 R47 K48

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5uq8, PDBe:5uq8, PDBj:5uq8
• PDBsum: 5uq8
• PubMed: 29456023
• UniProt: P80340|RL34_THET8 Large ribosomal subunit protein bL34 (Gene Name=rpmH)