Structure of PDB 5nd8 Chain 7

Receptor sequence
>5nd87 (length=60) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
PKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVS
KSDMKRVKQL
3D structure
PDB5nd8 Structures and dynamics of hibernating ribosomes from Staphylococcus aureus mediated by intermolecular interactions of HPF.
Chain7
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 7 P2 K3 M4 K5 T6 H7 R8 R16 Q21 R24 S25 A27 F28 S30 H31 F33 N35 K41 R42 L44 K52 M55 K59 P1 K2 M3 K4 T5 H6 R7 R15 Q20 R23 S24 A26 F27 S29 H30 F32 N34 K40 R41 L43 K51 M54 K58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nd8, PDBe:5nd8, PDBj:5nd8
PDBsum5nd8
PubMed28645916
UniProtQ2FXQ0|RL35_STAA8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]