Structure of PDB 5mmi Chain 7

Receptor sequence
>5mmi7 (length=46) Species: 3562 (Spinacia oleracea) [Search protein sequence]
SSRPQKKGTAHHMKTRPKKTARWDIKRGPAVYPPLPPLPAEWTIVS
3D structure
PDB5mmi The complete structure of the chloroplast 70S ribosome in complex with translation factor pY.
Chain7
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 7 S48 S49 R50 P51 Q52 K54 T56 H59 M60 R63 P64 K66 W70 K73 R74 P76 Y79 S1 S2 R3 P4 Q5 K7 T9 H12 M13 R16 P17 K19 W23 K26 R27 P29 Y32
BS02 rna 7 R50 K53 K65 R3 K6 K18
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0009507 chloroplast
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mmi, PDBe:5mmi, PDBj:5mmi
PDBsum5mmi
PubMed28007896
UniProtP82411|PSRP6_SPIOL Large ribosomal subunit protein cL38 (Gene Name=PSRP6)

[Back to BioLiP]