Structure of PDB 4v19 Chain 7

Receptor sequence
>4v197 (length=46) Species: 9823 (Sus scrofa) [Search protein sequence]
KARGNEYQPSNIKRKHKHGWVRRLRTPTGVQVILRRMHKGRKSLSH
3D structure
PDB4v19 The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
Chain7
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 7 K50 A51 R52 G53 N54 E55 Y56 Q57 P58 S59 N60 I61 K62 R63 K64 H65 K66 H67 G68 W69 V70 R72 L73 R74 T77 R84 R85 K88 G89 R90 K91 H95 K1 A2 R3 G4 N5 E6 Y7 Q8 P9 S10 N11 I12 K13 R14 K15 H16 K17 H18 G19 W20 V21 R23 L24 R25 T28 R35 R36 K39 G40 R41 K42 H46
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v19, PDBe:4v19, PDBj:4v19
PDBsum4v19
PubMed25271403
UniProtW5IDC1

[Back to BioLiP]