Structure of PDB 4ce4 Chain 7

Receptor sequence
>4ce47 (length=43) Species: 9825 (Sus scrofa domesticus) [Search protein sequence]
GNEYQPSNIKRKHKHGWVRRLRTPTGVQVILRRMHKGRKSLSH
3D structure
PDB4ce4 Architecture of the Large Subunit of the Mammalian Mitochondrial Ribosome.
Chain7
Resolution4.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 7 G53 N54 E55 Y56 Q57 P58 N60 R63 K66 H67 G68 W69 V70 T77 V81 R84 R85 K88 G89 R90 K91 H95 G1 N2 E3 Y4 Q5 P6 N8 R11 K14 H15 G16 W17 V18 T25 V29 R32 R33 K36 G37 R38 K39 H43
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ce4, PDBe:4ce4, PDBj:4ce4
PDBsum4ce4
PubMed24362565
UniProtW5IDC1

[Back to BioLiP]