Structure of PDB 8h6e Chain 6g

Receptor sequence
>8h6e6g (length=61) Species: 9606 (Homo sapiens) [Search protein sequence]
ALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHEEQVVLGLYIV
RGDNVAVIGEI
3D structure
PDB8h6e Structural Insights into Human Exon-defined Spliceosome Prior to Activation
Chain6g
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6g Q32 T33 Q29 T30
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0017070 U6 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005688 U6 snRNP
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0120115 Lsm2-8 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h6e, PDBe:8h6e, PDBj:8h6e
PDBsum8h6e
PubMed38658629
UniProtO95777|LSM8_HUMAN U6 snRNA-associated Sm-like protein LSm8 (Gene Name=LSM8)

[Back to BioLiP]