Structure of PDB 8h6j Chain 6a

Receptor sequence
>8h6j6a (length=89) Species: 9606 (Homo sapiens) [Search protein sequence]
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEK
YPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKE
3D structure
PDB8h6j Atomic structures of human exon-defined spliceosome prior to activation.
Chain6a
Resolution3.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6a Y35 S65 Y35 S65
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0017070 U6 snRNA binding
GO:0031267 small GTPase binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006402 mRNA catabolic process
GO:0008380 RNA splicing
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005688 U6 snRNP
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0120115 Lsm2-8 complex
GO:1990726 Lsm1-7-Pat1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h6j, PDBe:8h6j, PDBj:8h6j
PDBsum8h6j
PubMed38658629
UniProtQ9Y333|LSM2_HUMAN U6 snRNA-associated Sm-like protein LSm2 (Gene Name=LSM2)

[Back to BioLiP]