Structure of PDB 7y5e Chain 6N

Receptor sequence

>7y5e6N (length=169) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

FMEAPAALDGSMVGDVGFDPLGFSNYIDLKFLREAELKHCRICMLAALGI
IVQEVYQFPFYSGAPRLATDAHDYFVKFGSLNQILLFASFIELVAGTPGI
IQTMRGETDRAPGYFAFDPLGLGKDKAKFERYQLSELKNGRLAMIAVGGF
IHQAWMAKVPVLEQLSTGK

3D structure

PDB

7y5e In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	6N	V62 F64	V16 F18
BS02	CLA	6N	G60 V62 D65 L78 R79 E82 H85 R187	G14 V16 D19 L32 R33 E36 H39 R141
BS03	CLA	6N	F77 H85 M190	F31 H39 M144
BS04	CLA	6N	L91 A92 G95 V98 Q99 F104 Y107 F121 L127	L45 A46 G49 V52 Q53 F58 Y61 F75 L81
BS05	CLA	6N	Y107 F121 S126 Q129 F133	Y61 F75 S80 Q83 F87
BS06	CLA	6N	H118 L127	H72 L81
BS07	CLA	6N	F77 E80 A81 K84 H85 I88 E138 I146	F31 E34 A35 K38 H39 I42 E92 I100
BS08	CLA	6N	R87 M90 L91 Y160 F161 A162 F163 D164 E182	R41 M44 L45 Y114 F115 A116 F117 D118 E136
BS09	CLA	6N	L94 S181 N185	L48 S135 N139
BS10	CLA	6N	G195 Q199	G149 Q153
BS11	CLA	6N	H198 W201	H152 W155

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7y5e, PDBe:7y5e, PDBj:7y5e
PDBsum	7y5e
PubMed	36922595
UniProt	A0A5J4YN76

[Back to BioLiP]