Structure of PDB 4wzo Chain 6E

Receptor sequence

>4wzo6E (length=155) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLAL
RWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAY
AHYRW

3D structure

PDB

4wzo Structural insights into the translational infidelity mechanism.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	6E	A2 R3 R4 R5 R6 A7 R10 L12 N28 K29 R32 D33 G34 K35 K36 N37 L38 R41 I42 R76 R94 S98 R102 R114 R115 A116 R119	A1 R2 R3 R4 R5 A6 R9 L11 N27 K28 R31 D32 G33 K34 K35 N36 L37 R40 I41 R75 R93 S97 R101 R113 R114 A115 R118
BS02	rna	6E	S77 R143 M144 A147	S76 R142 M143 A146

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4wzo, PDBe:4wzo, PDBj:4wzo
PDBsum	4wzo
PubMed	26037619
UniProt	P17291\|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]