Structure of PDB 4wr6 Chain 6A

Receptor sequence
>4wr66A (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB4wr6 Structural insights into the translational infidelity mechanism.
Chain6A
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6A P2 K5 K8 Q9 F18 D21 T22 G23 Q28 L31 R35 R38 L39 H42 H46 K48 D49 H50 H51 S52 R54 M58 G61 R64 R65 R68 Y69 R72 P1 K4 K7 Q8 F17 D20 T21 G22 Q27 L30 R34 R37 L38 H41 H45 K47 D48 H49 H50 S51 R53 M57 G60 R63 R64 R67 Y68 R71
BS02 rna 6A L56 G89 L55 G88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wr6, PDBe:4wr6, PDBj:4wr6
PDBsum4wr6
PubMed26037619
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]