Structure of PDB 4wzo Chain 69

Receptor sequence
>4wzo69 (length=146) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKVILLEPLENLGDVGQVVDVKPGYARNYLLPRGLAVLATESNLKALEAR
IRAQAKRLAERKAEAERLKEILENLTLTIPVRAGETKIYGSVTAKDIAEA
LSRQHGVTIDPKRLALEKPIKELGEYVLTYKPHPEVPIQLKVSVVA
3D structure
PDB4wzo Structural insights into the translational infidelity mechanism.
Chain69
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 69 E10 R82 K87 Y89 G90 S91 K121 E10 R82 K87 Y89 G90 S91 K121
BS02 rna 69 K22 P23 G24 Y25 N28 Y29 R33 S42 K45 A46 R50 R57 K22 P23 G24 Y25 N28 Y29 R33 S42 K45 A46 R50 R57
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wzo, PDBe:4wzo, PDBj:4wzo
PDBsum4wzo
PubMed26037619
UniProtQ5SLQ1|RL9_THET8 Large ribosomal subunit protein bL9 (Gene Name=rplI)

[Back to BioLiP]