Structure of PDB 3j77 Chain 69

Receptor sequence

>3j7769 (length=188) Species: 4932 (Saccharomyces cerevisiae)

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRV
LRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQR
EKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA

3D structure

• PDB: 3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
• Chain: 69
• Resolution: 6.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	69	R163 N166 A169 R172 R173 R176	R162 N165 A168 R171 R172 R175
BS02	rna	69	A2 N3 L4 R5 T6 R9 L10 V17 G18 R20 V22 L24 R38 K43 T56 H58 S59 K60 R62 R64 R71 R74 H75 G77 Y78 G79 K82 G83 T84 R85 A87 R88 L89 W95 R100 V101 R103 R104 K117 H118 Y120 H121 Y124 K125 K128 G129 H134 K135 R136 K146	A1 N2 L3 R4 T5 R8 L9 V16 G17 R19 V21 L23 R37 K42 T55 H57 S58 K59 R61 R63 R70 R73 H74 G76 Y77 G78 K81 G82 T83 R84 A86 R87 L88 W94 R99 V100 R102 R103 K116 H117 Y119 H120 Y123 K124 K127 G128 H133 K134 R135 K145

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j77, PDBe:3j77, PDBj:3j77
• PDBsum: 3j77
• PubMed: 25043550
• UniProt: P0CX82|RL19A_YEAST Large ribosomal subunit protein eL19A (Gene Name=RPL19A)