Structure of PDB 3j6x Chain 69

Receptor sequence
>3j6x69 (length=58) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]
AKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTA
KALAAAKK
3D structure
PDB3j6x Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
Chain69
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 69 A2 K5 H7 T8 A9 H10 T13 H17 N19 T26 K28 Y29 P30 S31 L32 R41 N42 H43 K44 H45 A46 G49 A1 K4 H6 T7 A8 H9 T12 H16 N18 T25 K27 Y28 P29 S30 L31 R40 N41 H42 K43 H44 A45 G48
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6x, PDBe:3j6x, PDBj:3j6x
PDBsum3j6x
PubMed24927574
UniProtP05747|RL29_YEAST Large ribosomal subunit protein eL29 (Gene Name=RPL29)

[Back to BioLiP]