Structure of PDB 8r08 Chain 68

Receptor sequence

>8r0868 (length=95) Species: 9606 (Homo sapiens)

TSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQG
VEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

3D structure

• PDB: 8r08 Structural insights into the cross-exon to cross-intron spliceosome switch
• Chain: 68
• Resolution: 6.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	68	G64 D65 V94	G63 D64 V93

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0005515 protein binding
• GO:0017070 U6 snRNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005688 U6 snRNP
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071011 precatalytic spliceosome
• GO:0120115 Lsm2-8 complex

External links

• PDB: RCSB:8r08, PDBe:8r08, PDBj:8r08
• PDBsum: 8r08
• PubMed: 38778104
• UniProt: O95777|LSM8_HUMAN U6 snRNA-associated Sm-like protein LSm8 (Gene Name=LSM8)