Structure of PDB 3j77 Chain 68

Receptor sequence

>3j7768 (length=185) Species: 4932 (Saccharomyces cerevisiae)

GIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKA
LFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTV
AALRFTAGARAKIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVR
HFGMGPHKGKAPRILSTGRKFERARGRRRSKGFKV

3D structure

• PDB: 3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
• Chain: 68
• Resolution: 6.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	68	G2 H5 K8 Q9 H10 R12 G14 H15 R16 K20 S21 R38 R39 P43 L54 S55 K56 N58 S63 S65 R66 R69 E74 T86 T88 D89 D90 R92 I93 T107 A108 G134 Q135 L140 R141 G142 P143 R144 N145 S146 F153 G154 G160 A162 P163 R164 S167 R170 K171 F172 R174 R176 R179 R180 S181 K182 G183 F184 K185	G1 H4 K7 Q8 H9 R11 G13 H14 R15 K19 S20 R37 R38 P42 L53 S54 K55 N57 S62 S64 R65 R68 E73 T85 T87 D88 D89 R91 I92 T106 A107 G133 Q134 L139 R140 G141 P142 R143 N144 S145 F152 G153 G159 A161 P162 R163 S166 R169 K170 F171 R173 R175 R178 R179 S180 K181 G182 F183 K184

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j77, PDBe:3j77, PDBj:3j77
• PDBsum: 3j77
• PubMed: 25043550
• UniProt: P0CX49|RL18A_YEAST Large ribosomal subunit protein eL18A (Gene Name=RPL18A)