Structure of PDB 3j78 Chain 67

Receptor sequence

>3j7867 (length=183) Species: 4932 (Saccharomyces cerevisiae)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEAVAKAAEKKVVRLTSRQRGRIAAQKRIAA

3D structure

• PDB: 3j78 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
• Chain: 67
• Resolution: 6.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	67	R3 S16 A17 R18 Y21 S25 K27 Q34 Q55 F63 S65 S66 I67 G68 R69 A71 Q72 K74 K80 R82 W83 P84 K86 N97 N101 H116 Q118 Q121 R127 Y130 R131 A132 H133 G134 I136 K138 Y139 S141 T169 S170 R171 Q172 G174 R175	R2 S15 A16 R17 Y20 S24 K26 Q33 Q54 F62 S64 S65 I66 G67 R68 A70 Q71 K73 K79 R81 W82 P83 K85 N96 N100 H115 Q117 Q120 R126 Y129 R130 A131 H132 G133 I135 K137 Y138 S140 T168 S169 R170 Q171 G173 R174
BS02	rna	67	R3 Y4 G5 R61 R62 N120 Q121 P123	R2 Y3 G4 R60 R61 N119 Q120 P122

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j78, PDBe:3j78, PDBj:3j78
• PDBsum: 3j78
• PubMed: 25043550
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)