Structure of PDB 6qx9 Chain 66

Receptor sequence
>6qx966 (length=72) Species: 9606 (Homo sapiens) [Search protein sequence]
QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQ
LKNKYGDAFIRGNNVLYISTQK
3D structure
PDB6qx9 Mechanism of 5' splice site transfer for human spliceosome activation.
Chain66
Resolution3.28 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 66 R66 N68 R61 N63
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006364 rRNA processing
GO:0006397 mRNA processing
GO:0006402 mRNA catabolic process
GO:0008033 tRNA processing
GO:0008380 RNA splicing
GO:0030490 maturation of SSU-rRNA
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005688 U6 snRNP
GO:0005730 nucleolus
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030532 small nuclear ribonucleoprotein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0120114 Sm-like protein family complex
GO:0120115 Lsm2-8 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qx9, PDBe:6qx9, PDBj:6qx9
PDBsum6qx9
PubMed30975767
UniProtP62312|LSM6_HUMAN U6 snRNA-associated Sm-like protein LSm6 (Gene Name=LSM6)

[Back to BioLiP]