Structure of PDB 3j77 Chain 65

Receptor sequence

>3j7765 (length=203) Species: 4932 (Saccharomyces cerevisiae)

GAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRL
GYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRAT
AEERVGRRAANLRVLNSYWVNQDSTYKYFEVILVDPQHKAIRRDARYNWI
CDPVHKHREARGLTATGKKSRGINKGHKFNNTKAGRRKTWKRQNTLSLWR
YRK

3D structure

• PDB: 3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
• Chain: 65
• Resolution: 6.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	65	G2 Y4 Q11 R12 K14 R20 R24 W28 R31 V35 R41 K47 R49 R50 L51 K54 A55 Q57 R67 R68 G69 N70 R71 K72 R73 P74 K77 Y81 G82 K83 P84 T85 Q87 V89 N90 E91 K93 Y94 Q95 R96 R105 R108 A111 N112 W120 D124 Y127 K128 Q138 H139 K140 A141 R147 W150 P154 K157 A161 R162 A166 K169 S171 R172 I174 K176 G177 H178 K179 N182 R187 R188 K189 W191 K192 Q194 S198 W200 Y202 R203 K204	G1 Y3 Q10 R11 K13 R19 R23 W27 R30 V34 R40 K46 R48 R49 L50 K53 A54 Q56 R66 R67 G68 N69 R70 K71 R72 P73 K76 Y80 G81 K82 P83 T84 Q86 V88 N89 E90 K92 Y93 Q94 R95 R104 R107 A110 N111 W119 D123 Y126 K127 Q137 H138 K139 A140 R146 W149 P153 K156 A160 R161 A165 K168 S170 R171 I173 K175 G176 H177 K178 N181 R186 R187 K188 W190 K191 Q193 S197 W199 Y201 R202 K203
BS02	rna	65	R38 Q57 G58 V60 Y62 R109 N112 H139	R37 Q56 G57 V59 Y61 R108 N111 H138

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j77, PDBe:3j77, PDBj:3j77
• PDBsum: 3j77
• PubMed: 25043550
• UniProt: P05748|RL15A_YEAST Large ribosomal subunit protein eL15A (Gene Name=RPL15A)