Structure of PDB 3j6y Chain 65

Receptor sequence
>3j6y65 (length=121) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]
KALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSET
AMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKK
AYVRLTADYDALDIANRIGYI
3D structure
PDB3j6y Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
Chain65
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 65 L24 A30 F32 R33 L34 T37 L40 R42 K45 Y46 T71 N91 Y93 K109 N111 T112 L113 Y123 R125 L3 A9 F11 R12 L13 T16 L19 R21 K24 Y25 T50 N70 Y72 K88 N90 T91 L92 Y102 R104
BS02 rna 65 L24 S48 P52 H53 N55 R56 Y93 L3 S27 P31 H32 N34 R35 Y72
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6y, PDBe:3j6y, PDBj:3j6y
PDBsum3j6y
PubMed24927574
UniProtP04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]