Structure of PDB 8rm5 Chain 63

Receptor sequence
>8rm563 (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
VEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTT
IEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPP
3D structure
PDB8rm5 Structural insights into the cross-exon to cross-intron spliceosome switch
Chain63
Resolution6.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 63 G89 D90 G76 D77
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030629 U6 snRNA 3'-end binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0033962 P-body assembly
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005688 U6 snRNP
GO:0005829 cytosol
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0120115 Lsm2-8 complex
GO:1990726 Lsm1-7-Pat1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rm5, PDBe:8rm5, PDBj:8rm5
PDBsum8rm5
PubMed38778104
UniProtP62310|LSM3_HUMAN U6 snRNA-associated Sm-like protein LSm3 (Gene Name=LSM3)

[Back to BioLiP]