Structure of PDB 5e7k Chain 62

Receptor sequence
>5e7k62 (length=138) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRVPMEVSPRRQQSLALRWLVQAANQR
PERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR
3D structure
PDB5e7k Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
Chain62
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 62 A2 R3 R4 R5 R6 R10 N28 K29 I30 M31 R32 D33 G34 N37 L38 R41 R76 R95 S98 R102 R114 R115 A116 A1 R2 R3 R4 R5 R9 N27 K28 I29 M30 R31 D32 G33 N36 L37 R40 R75 R84 S87 R91 R103 R104 A105
BS02 rna 62 E142 R143 E131 R132
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5e7k, PDBe:5e7k, PDBj:5e7k
PDBsum5e7k
PubMed26791911
UniProtP17291|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]