Structure of PDB 3j77 Chain 62

Receptor sequence
>3j7762 (length=150) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
EVKYLYLRAVGGEVGLAPKIGPLGLSPKKVGEDIAKATKEKGIKVTVQLK
IQNRQAAASVVPSASSLVITALKEPPRDRKKDKNVKHSGNIQLDEIIEIA
RQMRDKSFGRTLASVTKEILGTAQSVGCRVDFKNPHDIIEGINAGEIEIP
3D structure
PDB3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
Chain62
Resolution6.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 62 A17 V18 A77 S79 V98 F121 G122 R123 V128 E131 I132 T135 A136 A9 V10 A64 S66 V85 F108 G109 R110 V115 E118 I119 T122 A123
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum3j77
PubMed25043550
UniProtP0CX53|RL12A_YEAST Large ribosomal subunit protein uL11A (Gene Name=RPL12A)

[Back to BioLiP]