Structure of PDB 3j6y Chain 61

Receptor sequence

>3j6y61 (length=159) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]

GKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKG
MPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKC
RQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQTL
APVPYETFI

3D structure

PDB

3j6y Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.

Chain

Resolution

6.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	61	K3 S4 H5 G6 Y7 R8 S9 R10 R12 Y13 M14 Q16 R17 F19 G23 K35 K43 G46 S47 Q49 K50 G51 H54 K55 Q58 G59 K60 T61 T68 S71 K78 V80 R88 N90 K100 R102 F105 R116 K120 V126 Q127 L128 K129 R130	K2 S3 H4 G5 Y6 R7 S8 R9 R11 Y12 M13 Q15 R16 F18 G22 K34 K42 G45 S46 Q48 K49 G50 H53 K54 Q57 G58 K59 T60 T67 S70 K77 V79 R87 N89 K99 R101 F104 R115 K119 V125 Q126 L127 K128 R129
BS02	rna	61	R20 H26 L27 S28	R19 H25 L26 S27

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j6y, PDBe:3j6y, PDBj:3j6y
PDBsum	3j6y
PubMed	24927574
UniProt	Q02753\|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)

[Back to BioLiP]