Structure of PDB 8wib Chain 6

Receptor sequence
>8wib6 (length=48) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
VRPKITLACEVCKHRNYITKKNRRNDPDRLEIKKFCPNCGTHQPHKES
3D structure
PDB8wib Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chain6
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 6 R8 K10 Y23 I24 T25 N28 I38 K39 K40 F41 H48 R2 K4 Y17 I18 T19 N22 I32 K33 K34 F35 H42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8wib, PDBe:8wib, PDBj:8wib
PDBsum8wib
PubMed38245551
UniProtA0QS39|RL331_MYCS2 Large ribosomal subunit protein bL33A (Gene Name=rpmG1)

[Back to BioLiP]