Structure of PDB 8uu9 Chain 6

Receptor sequence
>8uu96 (length=43) Species: 1642 (Listeria innocua) [Search protein sequence]
MKRTYQPSKRKRKKVHGFRTRMSTKNGRRVLASRRRKGRKVLS
3D structure
PDB8uu9 Mechanistic insights into the alternative ribosome recycling by HflXr.
Chain6
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 M1 R3 T4 Y5 Q6 P7 K9 R10 R12 K13 H16 F18 R19 R21 K25 N26 R29 R34 R35 R36 K37 G38 R39 K40 M1 R3 T4 Y5 Q6 P7 K9 R10 R12 K13 H16 F18 R19 R21 K25 N26 R29 R34 R35 R36 K37 G38 R39 K40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8uu9, PDBe:8uu9, PDBj:8uu9
PDBsum8uu9
PubMed38407413
UniProtA0A660JKZ6

[Back to BioLiP]