Structure of PDB 8s1p Chain 6

Receptor sequence
>8s1p6 (length=46) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MKAGIHPNFKKATVKCACGNEFETGSVKEEVRVEICSECHPFYTGR
3D structure
PDB8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
Chain6
Resolution1.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 M1 K2 H6 M1 K2 H6
BS02 ZN 6 C16 C18 C36 C39 C16 C18 C36 C39
Gene Ontology
Molecular Function
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum8s1p
PubMed38811035
UniProtQ03223|RL31_BACSU Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]