Structure of PDB 8rgp Chain 6

Receptor sequence
>8rgp6 (length=155) Species: 10090 (Mus musculus) [Search protein sequence]
RAEYVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGV
VFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGG
YYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIKREQKLK
IWYRR
3D structure
PDB8rgp SCAF1 drives the compositional diversity of mammalian respirasomes.
Chain6
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 6 C64 C65 G127 S128 C129 C159 P160 C30 C31 G93 S94 C95 C125 P126
BS02 UQ 6 W56 F60 G61 L62 M70 V85 F86 W22 F26 G27 L28 M36 V51 F52
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0048038 quinone binding
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0009060 aerobic respiration
GO:0032981 mitochondrial respiratory chain complex I assembly
GO:0042776 proton motive force-driven mitochondrial ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rgp, PDBe:8rgp, PDBj:8rgp
PDBsum8rgp
PubMed38575788
UniProtQ9DC70|NDUS7_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial (Gene Name=Ndufs7)

[Back to BioLiP]