Structure of PDB 8qu1 Chain 6

Receptor sequence
>8qu16 (length=35) Species: 9606 (Homo sapiens) [Search protein sequence]
RRTPPLGPMPNSDIDLSNLERLEKYRSFDRYRRRA
3D structure
PDB8qu1 GTPBP8 plays a role in mitoribosome formation in human mitochondria.
Chain6
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 R27 R28 R1 R2
BS02 rna 6 R52 S53 R56 R26 S27 R30
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qu1, PDBe:8qu1, PDBj:8qu1
PDBsum8qu1
PubMed38969660
UniProtQ96DV4|RM38_HUMAN Large ribosomal subunit protein mL38 (Gene Name=MRPL38)

[Back to BioLiP]