Structure of PDB 8qpp Chain 6 |
>8qpp6 (length=63) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
MKAGIHPNFKKATVKCACGNEFETGSVKEEVRVEICSECHPFYTGRQKFA SADGRVDRFNKKY |
|
PDB | 8qpp An evolutionarily conserved strategy for ribosome binding and inhibition by beta-coronavirus non-structural protein 1 |
Chain | 6 |
Resolution | 3.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
6 |
M1 K2 H6 |
M1 K2 H6 |
|
|
|
|