Structure of PDB 8q5i Chain 6

Receptor sequence
>8q5i6 (length=131) Species: 5476 (Candida albicans) [Search protein sequence]
SGNKFRMSLALPVGAVMNCADNSGARNLYVLAVKGTGARLNRLPAAAAGD
MVMATVKKGKPELRKKVMPAIVIRQSKPWRRRDGVYLYFEDNAGVIVNPK
GEMKGSAITGPVAKECADLWPRIASNSGVVV
3D structure
PDB8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
Chain6
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 S7 G8 N9 F11 R12 S14 A16 P18 A21 V22 Y35 L37 K40 G41 T42 A44 R45 L46 N47 R48 L49 M59 T61 K63 K71 V73 K83 R86 Y92 N98 S1 G2 N3 F5 R6 S8 A10 P12 A15 V16 Y29 L31 K34 G35 T36 A38 R39 L40 N41 R42 L43 M53 T55 K57 K65 V67 K77 R80 Y86 N92
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum8q5i
PubMed
UniProtA0A8H6C444

[Back to BioLiP]