Structure of PDB 8p2f Chain 6

Receptor sequence
>8p2f6 (length=48) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
MRVNVTLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRET
3D structure
PDB8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
Chain6
Resolution2.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 M1 R15 Y17 I18 T19 N22 N25 M32 K33 K34 Y35 R38 N40 Y42 M1 R15 Y17 I18 T19 N22 N25 M32 K33 K34 Y35 R38 N40 Y42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
PDBsum8p2f
PubMed38902339
UniProtQ2FYU6|RL331_STAA8 Large ribosomal subunit protein bL33A (Gene Name=rpmG1)

[Back to BioLiP]